Recombinant Enterobacteria phage M13 Tail virion protein G9P (IX)

Product Description

Recombinant Enterobacteria phage M13 Tail virion protein G9P (IX) is available at Gentaur for Next week Delivery.

Gene Name: IX

Alternative Names : Coat protein C, polypeptide II G9P

Expression Region : 1-32aa

AA Sequence : MSVLVYSFASFVLGWCLRSGITYFTRLMETSS

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 19.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.

Function : May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host.

Involvement in disease :

Subcellular location : Virion, Host membrane, Single-pass membrane protein

Protein Families : Inovirus G9P protein family

Tissue Specificity :

Paythway :

Uniprot ID : P69538