Recombinant Escherichia coli 30S ribosomal protein S15 (rpsO)

Product Description

Recombinant Escherichia coli 30S ribosomal protein S15 (rpsO) is available at Gentaur for Next week Delivery.

Gene Name: rpsO

Alternative Names :

Expression Region : 2-89aa

AA Sequence : SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 14.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assbly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA.In the E.coli 70S ribosome it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B4. In the two 3.5 A resolved ribosome structures there are minor differences between side-chain conformations.

Function : One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA

Involvement in disease :

Subcellular location :

Protein Families : Universal ribosomal protein uS15 family

Tissue Specificity :

Paythway :

Uniprot ID : P0ADZ4