Recombinant Escherichia coli 30S ribosomal protein S18 (rpsR)

Product Description

Recombinant Escherichia coli 30S ribosomal protein S18 (rpsR) is available at Gentaur for Next week Delivery.

Gene Name: rpsR

Alternative Names :

Expression Region : 2-75aa

AA Sequence : ARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTDRHQ

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal GST-tagged

Theoretical MW : 35.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit.

Function : Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit.

Involvement in disease :

Subcellular location :

Protein Families : Bacterial ribosomal protein bS18 family

Tissue Specificity :

Paythway :

Uniprot ID : P0A7T7