Euro
British Pound
US Dollar
Product Description
Recombinant Escherichia coli 30S ribosomal protein S21 (rpsU) is available at Gentaur for Next week Delivery.
Gene Name: rpsU
Alternative Names :
Expression Region : 2-71aa
AA Sequence : PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal GST-tagged
Theoretical MW : 35.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location :
Protein Families : Bacterial ribosomal protein bS21 family
Tissue Specificity :
Paythway :
Uniprot ID : P68679
