Euro
British Pound
US Dollar
Product Description
Recombinant Escherichia coli 30S ribosomal protein S3 (rpsC) is available at Gentaur for Next week Delivery.
Gene Name: rpsC
Alternative Names :
Expression Region : 2-233aa
AA Sequence : GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal GST-tagged
Theoretical MW : 52.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation .Plays a role in mRNA unwinding by the ribosome, possibly by forming part of a processivity clamp.
Function : Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation (By similarity).
Involvement in disease :
Subcellular location :
Protein Families : Universal ribosomal protein uS3 family
Tissue Specificity :
Paythway :
Uniprot ID : P0A7V3
