Euro
British Pound
US Dollar
Product Description
Recombinant Escherichia coli Acyl carrier protein (acpP) is available at Gentaur for Next week Delivery.
Gene Name: acpP
Alternative Names : Cytosolic-activating factor
Expression Region : 1-78aa
AA Sequence : MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 24.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Carrier of the growing fatty acid chain in fatty acid biosynthesis.
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P0A6A8
![Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 1 (fabB)](https://cdn11.bigcommerce.com/s-xsxw42fzca/images/stencil/500x659/products/2976/5363/biomatik__62975.1619617016__95788.1619624244.png?c=1 "Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 1 (fabB)")
![Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 2 (fabF)](https://cdn11.bigcommerce.com/s-xsxw42fzca/images/stencil/500x659/products/2977/5364/biomatik__62975.1619617016__22126.1619624245.png?c=1 "Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 2 (fabF)")
