Recombinant Escherichia coli Glyoxylate/hydroxypyruvate reductase A (ghrA)

Product Description

Recombinant Escherichia coli Glyoxylate/hydroxypyruvate reductase A (ghrA) is available at Gentaur for Next week Delivery.

Gene Name: ghrA

Alternative Names : 2-ketoacid reductase

Expression Region : 1-312aa

AA Sequence : MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY

Sequence Info : Full Length

Tag Info : Tag-Free

Theoretical MW : 35.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively.

Function : Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : D-isomer specific 2-hydroxyacid dehydrogenase family, GhrA subfamily

Tissue Specificity :

Paythway :

Uniprot ID : B7LFE3