Recombinant Escherichia coli Heat-labile enterotoxin A chain (eltA)

Product Description

Recombinant Escherichia coli Heat-labile enterotoxin A chain (eltA) is available at Gentaur for Next week Delivery.

Gene Name: eltA

Alternative Names : LT-A, porcine LTP-A

Expression Region : 19-258aa

AA Sequence : NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 45.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.

Function : The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.

Involvement in disease :

Subcellular location :

Protein Families : Enterotoxin A family

Tissue Specificity :

Paythway :

Uniprot ID : P06717