Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) (Active)

Product Description

Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) (Active) is available at Gentaur for Next week Delivery.

Gene Name: YTFE

Alternative Names : Regulator of cell morphogenesis and NO signaling

Expression Region : 1-220aa

AA Sequence : MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 51.9 kD

Storage Buffer : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 ?g/ml can bind human ytfE, the EC50 of human ytfE protein is 197.90-259.70 ?g/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P69506