Product Description
Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) (Active) is available at Gentaur for Next week Delivery.
Gene Name: YTFE
Alternative Names : Regulator of cell morphogenesis and NO signaling
Expression Region : 1-220aa
AA Sequence : MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 51.9 kD
Storage Buffer : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 ?g/ml can bind human ytfE, the EC50 of human ytfE protein is 197.90-259.70 ?g/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions.
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P69506
Euro
British Pound
US Dollar