Recombinant Escherichia coli Major outer membrane prolipoprotein Lpp (lpp)

Product Description

Recombinant Escherichia coli Major outer membrane prolipoprotein Lpp (lpp) is available at Gentaur for Next week Delivery.

Gene Name: lpp

Alternative Names : Braun lipoprotein (Murein-lipoprotein) (mlpA) (mulI)

Expression Region : 21-78aa

AA Sequence : CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-KSI-tagged

Theoretical MW : 21.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Interacts with the peptidoglycan both covalently and noncovalently. This interaction contributes to the maintenance of the structural and functional integrity of the cell envelope.

Function : Interacts with the peptidoglycan both covalently and noncovalently. This interaction contributes to the maintenance of the structural and functional integrity of the cell envelope.

Involvement in disease :

Subcellular location : Cell outer membrane, Lipid-anchor, Cell outer membrane, Peptidoglycan-anchor

Protein Families : Lpp family

Tissue Specificity :

Paythway :

Uniprot ID : P69776