Recombinant Escherichia coli O157:H7 DNA-binding protein HU-alpha (hupA)

Product Description

Recombinant Escherichia coli O157:H7 DNA-binding protein HU-alpha (hupA) is available at Gentaur for Next week Delivery.

Gene Name: hupA

Alternative Names : HU-2 NS2

Expression Region : 1-90aa

AA Sequence : MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 25.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions.

Function : Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions.

Involvement in disease :

Subcellular location :

Protein Families : Bacterial histone-like protein family

Tissue Specificity :

Paythway :

Uniprot ID : P0ACF2