Product Description
Recombinant Escherichia coli O6:H1 Lipopolysaccharide export system protein LptC (lptC) is available at Gentaur for Next week Delivery.
Gene Name: lptC
Alternative Names :
Expression Region : 1-191aa
AA Sequence : MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 23.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in the assbly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner mbrane to the outer mbrane. Facilitates the transfer of LPS from the inner mbrane to the periplasmic protein LptA. Could be a docking site for LptA.
Function : Involved in the assembly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner membrane to the outer membrane. Facilitates the transfer of LPS from the inner membrane to the periplasmic protein LptA. Could be a docking site for LptA.
Involvement in disease :
Subcellular location : Cell inner membrane, Single-pass membrane protein
Protein Families : LptC family
Tissue Specificity :
Paythway :
Uniprot ID : P0ADW0
Euro
British Pound
US Dollar