Recombinant Escherichia coli O6:H1 Lipopolysaccharide export system protein LptC (lptC)

Product Description

Recombinant Escherichia coli O6:H1 Lipopolysaccharide export system protein LptC (lptC) is available at Gentaur for Next week Delivery.

Gene Name: lptC

Alternative Names :

Expression Region : 1-191aa

AA Sequence : MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 23.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the assbly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner mbrane to the outer mbrane. Facilitates the transfer of LPS from the inner mbrane to the periplasmic protein LptA. Could be a docking site for LptA.

Function : Involved in the assembly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner membrane to the outer membrane. Facilitates the transfer of LPS from the inner membrane to the periplasmic protein LptA. Could be a docking site for LptA.

Involvement in disease :

Subcellular location : Cell inner membrane, Single-pass membrane protein

Protein Families : LptC family

Tissue Specificity :

Paythway :

Uniprot ID : P0ADW0