Product Description
Recombinant Escherichia coli Outer membrane protein F (ompF) is available at Gentaur for Next week Delivery.
Gene Name: ompF
Alternative Names : Outer membrane protein 1A (Outer membrane protein B) (Outer membrane protein IA) (Porin OmpF) (cmlB) (coa) (cry) (tolF)
Expression Region : 23-362aa
AA Sequence : AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 44.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Forms pores that allow passive diffusion of small molecules across the outer membrane. It is also a receptor for the bacteriophage T2.
Function : Forms pores that allow passive diffusion of small molecules across the outer membrane. It is also a receptor for the bacteriophage T2.
Involvement in disease :
Subcellular location : Cell outer membrane, Multi-pass membrane protein
Protein Families : Gram-negative porin family
Tissue Specificity :
Paythway :
Uniprot ID : P02931
Euro
British Pound
US Dollar