Recombinant Escherichia coli Plasmid-derived single-stranded DNA-binding protein (ssbF)

Product Description

Recombinant Escherichia coli Plasmid-derived single-stranded DNA-binding protein (ssbF) is available at Gentaur for Next week Delivery.

Gene Name: ssbF

Alternative Names : Helix-destabilizing protein

Expression Region : 2-179aa

AA Sequence : AVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQTGEMREQTEWHRVVLFGKLAEVAGECLRKGAQVYIEGQLRTRSWEDNGITRYVTEILVKTTGTMQMLVRAAGAQTQPEEGQQFSGQPQPEPQAEAGTKKGGAKTKGRGRKAAQPEPQPQPPEGDDYGFSDDIPF

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 35.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May contribute to the conjugative processing of DNA. It has a functional relationship with Psi (plasmid-mediated sos inhibition) proteins.

Function : May contribute to the conjugative processing of DNA. It has a functional relationship with Psi (plasmid-mediated sos inhibition) proteins.

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P18310