Recombinant Escherichia coli Probable diguanylate cyclase DgcQ (dgcQ), partial

Product Description

Recombinant Escherichia coli Probable diguanylate cyclase DgcQ (dgcQ), partial is available at Gentaur for Next week Delivery.

Gene Name: dgcQ

Alternative Names : Cellulose synthesis regulatory protein

Expression Region : 381-564aa

AA Sequence : RRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEKARPLAKLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRRLYLAKQAGRNRVFASDNA

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 47.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the regulation of cellulose production. Cyclic-di-GMP is a second messenger which controls cell surface-associated traits in bacteria.

Function : Involved in the regulation of cellulose production. Cyclic-di-GMP is a second messenger which controls cell surface-associated traits in bacteria.

Involvement in disease :

Subcellular location : Cell inner membrane, Multi-pass membrane protein

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P76330