Recombinant Escherichia coli Prophage outer membrane lipoprotein RzoR (rzoR)

Product Description

Recombinant Escherichia coli Prophage outer membrane lipoprotein RzoR (rzoR) is available at Gentaur for Next week Delivery.

Gene Name: rzoR

Alternative Names : Outer membrane lipoprotein Rz1 from lambdoid prophage Rac (Spanin from lambdoid prophage Rac, outer membrane subunit) (o-spanin)

Expression Region : 20-61aa

AA Sequence : CTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-Flag-tagged

Theoretical MW : 11.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Component of the spanin complex that disrupts the outer membrane and causes cell lysis during virus exit. The spanin complex conducts the final step in cell lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P58042