Recombinant Escherichia coli Recombination protein RecR (recR)

Product Description

Recombinant Escherichia coli Recombination protein RecR (recR) is available at Gentaur for Next week Delivery.

Gene Name: recR

Alternative Names :

Expression Region : 1-201aa

AA Sequence : MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 38 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in DNA repair. It ses to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO.

Function : May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO.

Involvement in disease :

Subcellular location :

Protein Families : RecR family

Tissue Specificity :

Paythway :

Uniprot ID : P0A7H6