Recombinant Escherichia coli Signal peptidase I (lepB), partial

Product Description

Recombinant Escherichia coli Signal peptidase I (lepB), partial is available at Gentaur for Next week Delivery.

Gene Name: lepB

Alternative Names : Leader peptidase I

Expression Region : 78-324aa

AA Sequence : RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 43.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.

Function :

Involvement in disease :

Subcellular location : Cell inner membrane, Multi-pass membrane protein

Protein Families : Peptidase S26 family

Tissue Specificity :

Paythway :

Uniprot ID : P00803