Euro
British Pound
US Dollar
Product Description
Recombinant Escherichia coli Transposase insE for insertion sequence IS3A (insE1) is available at Gentaur for Next week Delivery.
Gene Name: insE1
Alternative Names :
Expression Region : 1-99aa
AA Sequence : MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK
Sequence Info : Full Length
Tag Info : C-terminal FC-tagged
Theoretical MW : 37.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Microbiology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in the transposition of the insertion sequence IS3.
Function : Involved in the transposition of the insertion sequence IS3.
Involvement in disease :
Subcellular location :
Protein Families : Transposase 8 family
Tissue Specificity :
Paythway :
Uniprot ID : P0CF66
