Product Description
Recombinant Gloydius blomhoffii Disintegrin halysin is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : Platelet aggregation activation inhibitor
Expression Region : 1-71aa
AA Sequence : EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKKGTVCRIARGDDMDDYCNGISAGCPRNPF
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 9.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.
Function : Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Venom metalloproteinase (M12B) family, P-II subfamily, P-IIa sub-subfamily
Tissue Specificity : Expressed by the venom gland.
Paythway :
Uniprot ID : P21858
Euro
British Pound
US Dollar