Recombinant Gloydius blomhoffii Disintegrin halysin

Product Description

Recombinant Gloydius blomhoffii Disintegrin halysin is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Platelet aggregation activation inhibitor

Expression Region : 1-71aa

AA Sequence : EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKKGTVCRIARGDDMDDYCNGISAGCPRNPF

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 9.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.

Function : Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Venom metalloproteinase (M12B) family, P-II subfamily, P-IIa sub-subfamily

Tissue Specificity : Expressed by the venom gland.

Paythway :

Uniprot ID : P21858