Euro
British Pound
US Dollar
Product Description
Recombinant Green Fluorescent Protein (GFP) is available at Gentaur for Next week Delivery.
Gene Name: Green Fluorescent Protein
Alternative Names :
Expression Region : KETWWETWWTEWSQPKKKRKG-Met1~Lys238myc-FLAG tag
AA Sequence :
Sequence Info :
Tag Info : N-terminal His Tag
Theoretical MW : 37.0kDa
Storage Buffer : 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Endotoxin Level : <1.0EU per 1ug (determined by the LAL method)-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area :
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
