Recombinant Halobacterium salinarum Cobalamin import ATP-binding protein BtuD (btuD)

Product Description

Recombinant Halobacterium salinarum Cobalamin import ATP-binding protein BtuD (btuD) is available at Gentaur for Next week Delivery.

Gene Name: btuD

Alternative Names : Vitamin B12-transporting ATPase

Expression Region : 1-398aa

AA Sequence : MTLDVTGLDVELAGTRILDDVHASIRDGHLVGVVGPNGAGKSTLLRAMNGLITPTAGTVLVAGDDVHALSSAAASRRIATVPQDASVSFEFTVRQVVEMGRHPHTTRFGTDTDTAVVDRAMARTGVAQFAARDVTSLSGGERQRVLLARALAQAAPVLLLDEPTASLDVNHQIRTLEVVRDLADSEDRAVVAAIHDLDLAARYCDELVVVADGRVHDAGAPRSVLTPDTIRAAFDARVAVGTDPATGAVTVTPLPDRTSAAADTSVHVVGGGDSATPVVRRLVSAGASVSVGPVVEGDTDHETARRVGCPCTSVAPFTRLEDTTAASATRADIAAADVIAVPVAAAARPGVRGLLTGAVPTLAVGDAAGAPEWADRLVACDAVVSAVGALADTPSDGV

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 44.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin import. Probably responsible for energy coupling to the transport system.

Function : Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin (vitamin B12) import. Probably responsible for energy coupling to the transport system (By similarity).

Involvement in disease :

Subcellular location : Cell membrane, Peripheral membrane protein

Protein Families : ABC transporter superfamily

Tissue Specificity :

Paythway :

Uniprot ID : B0R5G4