Product Description
Recombinant Haplopelma schmidti Tau-theraphotoxin-Hs1a is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : Double-knot toxin (DkTx) (Tau-TRTX-Hs1a)
Expression Region : 1-79aa
AA Sequence : DCAKEGEVCSWGKKCCDLDNFYCPMEFIPHCKKYKPYVPVTTNCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYRGRND
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 13.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Selectively activates the heat-activated TRPV1 channel. It binds to TRPV1 in an open state-dependent manner, trapping it there to produce irreversible currents. It binds to the outer edge of the external pore of TRPV1 in a counterclockwise configuration, using a limited protein-protein interface and inserting hydrophobic residues into the bilayer. It also partitions naturally into membranes, with the two lobes exhibiting opposing energetics for membrane partitioning and channel activation. In addition, the toxin disrupts a cluster of hydrophobic residues behind the selectivity filter that are critical for channel activation.
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P0CH43
Euro
British Pound
US Dollar