Recombinant Helicobacter pylori Glutamate--tRNA ligase 1 (gltX1)

Product Description

Recombinant Helicobacter pylori Glutamate--tRNA ligase 1 (gltX1) is available at Gentaur for Next week Delivery.

Gene Name: gltX1

Alternative Names : Glutamyl-tRNA synthetase 1

Expression Region : 1-463aa

AA Sequence : MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQGKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYDGEILYQSKRFEIYKEYIQKLLDEDKAYYCYMSKEELDALREEQKARKETPRYDNRYRDFKGTPPKGIEPVVRIKVPQNEVIGFNDGVKGEVKVNTNELDDFIIARSDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVLYKALNFKIPNFFHVPMILNEEGQKLSKRHGATNVMDYQEMGYLKEALVNFLARLGWSYQDKEVFSMQELLELFDPKDLNSSPSCFSWHKLNWLNAHYLKNQSVQELLKLLKPFSFSDLSHLNPTQLDRLLDALKERSQTLKELALKIDEVLIAPVEYEEKVFKKLNQALVMPLLEKFKLELNKANFNDESALENAMRQIIEEEKIKAGSFMQPLRLALLGKGGGIGLKEALFILGKTESVKRIEDFLKN

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 55.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).

Function : Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Class-I aminoacyl-tRNA synthetase family, Glutamate--tRNA ligase type 1 subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P96551