Recombinant Helicobacter pylori Urease subunit alpha (ureA)

Product Description

Recombinant Helicobacter pylori Urease subunit alpha (ureA) is available at Gentaur for Next week Delivery.

Gene Name: ureA

Alternative Names : Urea amidohydrolase subunit alpha

Expression Region : 1-238aa

AA Sequence : MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 30.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Ammonia produced by ureolysis increases the gastric pH thereby providing an environment permissive for colonization of the stomach.

Function : Ammonia produced by ureolysis increases the gastric pH thereby providing an environment permissive for colonization of the stomach.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Urease gamma subunit family; Urease beta subunit family

Tissue Specificity :

Paythway :

Uniprot ID : P14916