Recombinant Hepatitis E virus genotype 1 Protein ORF3 (ORF3)

Product Description

Recombinant Hepatitis E virus genotype 1 Protein ORF3 (ORF3) is available at Gentaur for Next week Delivery.

Gene Name: ORF3

Alternative Names :

Expression Region : 1-114aa

AA Sequence : MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 27.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte.

Function : May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte.

Involvement in disease :

Subcellular location : Host cytoplasm, host cytoskeleton

Protein Families : Hepevirus ORF3 protein family

Tissue Specificity :

Paythway :

Uniprot ID : O90299