Recombinant Horse Major allergen Equ c 1

Product Description

Recombinant Horse Major allergen Equ c 1 is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Allergen: Equ c 1

Expression Region : 16-187aa

AA Sequence : QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 36.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location : Secreted

Protein Families : Calycin superfamily, Lipocalin family

Tissue Specificity : Expressed in liver and in sublingual and submaxillary salivary glands. Highly concentrated in secretory fluid such as saliva and urine as well as in hair dandruff extract.

Paythway :

Uniprot ID : Q95182