Recombinant Horse Myelin P2 protein (PMP2)

Product Description

Recombinant Horse Myelin P2 protein (PMP2) is available at Gentaur for Next week Delivery.

Gene Name: PMP2

Alternative Names :

Expression Region : 2-132aa

AA Sequence : SNKFLGTWKLTSSENFDEYMKALGVGLGTRSLGNLAGPTVIISKSGDVITIRTESGFKNTEISFKLGQEFEETTADNRKTKSTVTLAGGKLNQVQKWNGNETTIKRELVDGKMVVECSMASVVCTRIYEQV

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 30.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in lipid transport protein in Schwann cells. May bind cholesterol.

Function : May play a role in lipid transport protein in Schwann cells. May bind cholesterol.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Calycin superfamily, Fatty-acid binding protein (FABP) family

Tissue Specificity : Detected in spinal cord (at protein level).

Paythway :

Uniprot ID : P0C6G6