Product Description
Recombinant Horse Myelin P2 protein (PMP2) is available at Gentaur for Next week Delivery.
Gene Name: PMP2
Alternative Names :
Expression Region : 2-132aa
AA Sequence : SNKFLGTWKLTSSENFDEYMKALGVGLGTRSLGNLAGPTVIISKSGDVITIRTESGFKNTEISFKLGQEFEETTADNRKTKSTVTLAGGKLNQVQKWNGNETTIKRELVDGKMVVECSMASVVCTRIYEQV
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 30.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May play a role in lipid transport protein in Schwann cells. May bind cholesterol.
Function : May play a role in lipid transport protein in Schwann cells. May bind cholesterol.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Calycin superfamily, Fatty-acid binding protein (FABP) family
Tissue Specificity : Detected in spinal cord (at protein level).
Paythway :
Uniprot ID : P0C6G6
Euro
British Pound
US Dollar