Recombinant Human 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14)

Product Description

Recombinant Human 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14) is available at Gentaur for Next week Delivery.

Gene Name: HSD17B14

Alternative Names : 17-beta-hydroxysteroid dehydrogenase DHRS10Dehydrogenase/reductase SDR family member 10Retinal short-chain dehydrogenase/reductase retSDR3Short chain dehydrogenase/reductase family 47C member 1

Expression Region : 1-270aa

AA Sequence : MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 44.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro).

Function : Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro).

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Short-chain dehydrogenases/reductases (SDR) family

Tissue Specificity : Highly expressed in brain, placenta, liver and kidney.

Paythway :

Uniprot ID : Q9BPX1