Euro
British Pound
US Dollar
Product Description
Recombinant Human 28S ribosomal protein S16, mitochondrial (MRPS16) is available at Gentaur for Next week Delivery.
Gene Name: MRPS16
Alternative Names :
Expression Region : 1-137aa
AA Sequence : VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 38.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease : Combined oxidative phosphorylation deficiency 2 (COXPD2)
Subcellular location : Mitochondrion
Protein Families : Bacterial ribosomal protein bS16 family
Tissue Specificity :
Paythway :
Uniprot ID : Q9Y3D3
