Product Description
Recombinant Human 28S ribosomal protein S22, mitochondrial (MRPS22) is available at Gentaur for Next week Delivery.
Gene Name: MRPS22
Alternative Names :
Expression Region : 1-360aa
AA Sequence : MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 68.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease : Combined oxidative phosphorylation deficiency 5 (COXPD5)
Subcellular location : Mitochondrion
Protein Families : Mitochondrion-specific ribosomal protein mS22 family
Tissue Specificity :
Paythway :
Uniprot ID : P82650
Euro
British Pound
US Dollar