Product Description
Recombinant Human 3-ketoacyl-CoA thiolase, peroxisomal (ACAA1) is available at Gentaur for Next week Delivery.
Gene Name: ACAA1
Alternative Names : Acetyl-CoA acyltrans ferase;Beta-ketothiolase;Peroxisomal 3-oxoacyl-CoA thiolase
Expression Region : 27-331aa
AA Sequence : LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
Sequence Info : Full Length of Isoform 2
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 47.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Metabolism
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Peroxisome
Protein Families : Thiolase family
Tissue Specificity :
Paythway : PPARsignalingpathway
Uniprot ID : P09110