Product Description
Recombinant Human 39S ribosomal protein L42, mitochondrial (MRPL42) is available at Gentaur for Next week Delivery.
Gene Name: MRPL42
Alternative Names : 28S ribosomal protein S32, mitochondrial;MRP-S32;S32mt39S ribosomal protein L31, mitochondrial;L31mt;MRP-L31
Expression Region : 33-142aa
AA Sequence : KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal GST-tagged
Theoretical MW : 40.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Mitochondrion
Protein Families : Mitochondrion-specific ribosomal protein mL42 family
Tissue Specificity :
Paythway :
Uniprot ID : Q9Y6G3
Euro
British Pound
US Dollar