Recombinant Human 40S ribosomal protein S10 (RPS10), partial

Product Description

Recombinant Human 40S ribosomal protein S10 (RPS10), partial is available at Gentaur for Next week Delivery.

Gene Name: RPS10

Alternative Names :

Expression Region : 4-165aa

AA Sequence : PKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQPPQ

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 45.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Component of the 40S ribosomal subunit.

Function : Component of the 40S ribosomal subunit.

Involvement in disease : Diamond-Blackfan anemia 9 (DBA9)

Subcellular location : Cytoplasm, Nucleus, nucleolus

Protein Families : Eukaryotic ribosomal protein eS10 family

Tissue Specificity :

Paythway :

Uniprot ID : P46783