Recombinant Human 60S acidic ribosomal protein P2 (RPLP2), partial

Product Description

Recombinant Human 60S acidic ribosomal protein P2 (RPLP2), partial is available at Gentaur for Next week Delivery.

Gene Name: RPLP2

Alternative Names : Renal carcinoma antigen NY-REN-44

Expression Region : 1-113aa

AA Sequence : MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGL

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 38.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays an important role in the elongation step of protein synthesis.

Function : Plays an important role in the elongation step of protein synthesis.

Involvement in disease :

Subcellular location :

Protein Families : Eukaryotic ribosomal protein P1/P2 family

Tissue Specificity :

Paythway :

Uniprot ID : P05387