Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial

Product Description

Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial is available at Gentaur for Next week Delivery.

Gene Name: ADAMTS18

Alternative Names : ADAMTS21

Expression Region : 842-1047aa

AA Sequence : TCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGR

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 15.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease : Microcornea, myopic chorioretinal atrophy, and telecanthus (MMCAT)

Subcellular location : Secreted, extracellular space, extracellular matrix

Protein Families :

Tissue Specificity : Expressed in fetal lung, liver, and kidney and in adult brain, prostate, submaxillary gland, and endothelium.

Paythway :

Uniprot ID : Q8TE60