Product Description
Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial is available at Gentaur for Next week Delivery.
Gene Name: ADAMTS18
Alternative Names : ADAMTS21
Expression Region : 842-1047aa
AA Sequence : TCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGR
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 15.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease : Microcornea, myopic chorioretinal atrophy, and telecanthus (MMCAT)
Subcellular location : Secreted, extracellular space, extracellular matrix
Protein Families :
Tissue Specificity : Expressed in fetal lung, liver, and kidney and in adult brain, prostate, submaxillary gland, and endothelium.
Paythway :
Uniprot ID : Q8TE60
Euro
British Pound
US Dollar