Product Description
Recombinant Human Acidic fibroblast growth factor intracellular-binding protein (FIBP) is available at Gentaur for Next week Delivery.
Gene Name: FIBP
Alternative Names : FGF-1 intracellular-binding protein
Expression Region : 2-357aa
AA Sequence : TSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD
Sequence Info : Full Length of Isoform Short
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 57.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May be involved in mitogenic function of FGF1.
Function : May be involved in mitogenic function of FGF1. May mediate with IER2 FGF-signaling in the establishment of laterality in the embryo (By similarity).
Involvement in disease : Thauvin-Robinet-Faivre syndrome (TROFAS)
Subcellular location : Nucleus, Endomembrane system, Peripheral membrane protein
Protein Families :
Tissue Specificity : Highly expressed in heart, skeletal muscle and pancreas. Expressed at lower levels in brain. Also found in placenta, liver and kidney.
Paythway :
Uniprot ID : O43427
Euro
British Pound
US Dollar