Recombinant Human Acidic fibroblast growth factor intracellular-binding protein (FIBP)

Product Description

Recombinant Human Acidic fibroblast growth factor intracellular-binding protein (FIBP) is available at Gentaur for Next week Delivery.

Gene Name: FIBP

Alternative Names : FGF-1 intracellular-binding protein

Expression Region : 2-357aa

AA Sequence : TSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD

Sequence Info : Full Length of Isoform Short

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 57.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in mitogenic function of FGF1.

Function : May be involved in mitogenic function of FGF1. May mediate with IER2 FGF-signaling in the establishment of laterality in the embryo (By similarity).

Involvement in disease : Thauvin-Robinet-Faivre syndrome (TROFAS)

Subcellular location : Nucleus, Endomembrane system, Peripheral membrane protein

Protein Families :

Tissue Specificity : Highly expressed in heart, skeletal muscle and pancreas. Expressed at lower levels in brain. Also found in placenta, liver and kidney.

Paythway :

Uniprot ID : O43427