Recombinant Human Actin-related protein 2/3 complex subunit 3 (ARPC3), partial

Product Description

Recombinant Human Actin-related protein 2/3 complex subunit 3 (ARPC3), partial is available at Gentaur for Next week Delivery.

Gene Name: ARPC3

Alternative Names : Arp2/3 complex 21KDA subunit;p21-AR;C

Expression Region : 2-175aa

AA Sequence : PAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSG

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 47.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

Function : Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

Involvement in disease :

Subcellular location : Cytoplasm, cytoskeleton, Cell projection

Protein Families : ARPC3 family

Tissue Specificity :

Paythway : Regulationofactincytoskeleton

Uniprot ID : O15145