Product Description
Recombinant Human Actin-related protein 2/3 complex subunit 3 (ARPC3), partial is available at Gentaur for Next week Delivery.
Gene Name: ARPC3
Alternative Names : Arp2/3 complex 21KDA subunit;p21-AR;C
Expression Region : 2-175aa
AA Sequence : PAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSG
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 47.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.
Function : Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.
Involvement in disease :
Subcellular location : Cytoplasm, cytoskeleton, Cell projection
Protein Families : ARPC3 family
Tissue Specificity :
Paythway : Regulationofactincytoskeleton
Uniprot ID : O15145
Euro
British Pound
US Dollar