Recombinant Human Active regulator of SIRT1 protein (RPS19BP1)

Product Description

Recombinant Human Active regulator of SIRT1 protein (RPS19BP1) is available at Gentaur for Next week Delivery.

Gene Name: AROS

Alternative Names : 40S ribosomal protein S19-binding protein 1 Short name: RPS19-binding protein 1 Short name: S19BP

Expression Region : 1-145aa

AA Sequence : MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 42.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Direct regulator of SIRT1. Enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q86WX3