Recombinant Human Adenine phosphoribosyltransferase (APRT)

Product Description

Recombinant Human Adenine phosphoribosyltransferase (APRT) is available at Gentaur for Next week Delivery.

Gene Name: APRT

Alternative Names :

Expression Region : 1-180aa

AA Sequence : ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 46.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.

Function : Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.

Involvement in disease : Adenine phosphoribosyltransferase deficiency (APRTD)

Subcellular location : Cytoplasm

Protein Families : Purine/pyrimidine phosphoribosyltransferase family

Tissue Specificity :

Paythway :

Uniprot ID : P07741