Product Description
Recombinant Human Adenine phosphoribosyltransferase (APRT) is available at Gentaur for Next week Delivery.
Gene Name: APRT
Alternative Names :
Expression Region : 1-180aa
AA Sequence : ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 46.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Function : Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Involvement in disease : Adenine phosphoribosyltransferase deficiency (APRTD)
Subcellular location : Cytoplasm
Protein Families : Purine/pyrimidine phosphoribosyltransferase family
Tissue Specificity :
Paythway :
Uniprot ID : P07741
Euro
British Pound
US Dollar