Recombinant Human ADP-ribosylation factor 6 (ARF6)

Product Description

Recombinant Human ADP-ribosylation factor 6 (ARF6) is available at Gentaur for Next week Delivery.

Gene Name: ARF6

Alternative Names :

Expression Region : 1-175aa

AA Sequence : MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 36.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Developmental Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton rodeling. Required for normal completion of mitotic cytokinesis. Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers. May also modulate vesicle budding and uncoating within the Golgi apparatus. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase

Function : GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton remodeling. Required for normal completion of mitotic cytokinesis. Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers. May also modulate vesicle budding and uncoating within the Golgi apparatus. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Involved in epithelial polarization (By similarity).Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.

Involvement in disease :

Subcellular location : Cytoplasm, cytosol, Cell membrane, Lipid-anchor, Endosome membrane, Lipid-anchor, Recycling endosome membrane, Lipid-anchor, Cell projection, filopodium membrane, Lipid-anchor, Cell projection, ruffle, Cleavage furrow, Midbody, Midbody ring, Golgi apparatus

Protein Families : Small GTPase superfamily, Arf family

Tissue Specificity : Ubiquitous, with higher levels in heart, substantia nigra, and kidney.

Paythway : Rassignalingpathway

Uniprot ID : P62330