Recombinant Human AFG3-like protein 2 (AFG3L2), partial

Product Description

Recombinant Human AFG3-like protein 2 (AFG3L2), partial is available at Gentaur for Next week Delivery.

Gene Name: AFG3L2

Alternative Names : Paraplegin-like protein

Expression Region : 550-759aa

AA Sequence : ERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEF

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 50.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : ATP-dependent protease which is essential for axonal development.

Function : ATP-dependent protease which is essential for axonal and neuron development. In neurons, mediates degradation of SMDT1/EMRE before its assembly with the uniporter complex, limiting the availability of SMDT1/EMRE for MCU assembly and promoting efficient assembly of gatekeeper subunits with MCU

Involvement in disease : Spinocerebellar ataxia 28 (SCA28); Spastic ataxia 5, autosomal recessive (SPAX5)

Subcellular location : Mitochondrion, Mitochondrion inner membrane, Multi-pass membrane protein

Protein Families : AAA ATPase family; Peptidase M41 family

Tissue Specificity : Ubiquitous. Highly expressed in the cerebellar Purkinje cells.

Paythway :

Uniprot ID : Q9Y4W6