Product Description
Recombinant Human AFG3-like protein 2 (AFG3L2), partial is available at Gentaur for Next week Delivery.
Gene Name: AFG3L2
Alternative Names : Paraplegin-like protein
Expression Region : 550-759aa
AA Sequence : ERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEF
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 50.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Metabolism
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : ATP-dependent protease which is essential for axonal development.
Function : ATP-dependent protease which is essential for axonal and neuron development. In neurons, mediates degradation of SMDT1/EMRE before its assembly with the uniporter complex, limiting the availability of SMDT1/EMRE for MCU assembly and promoting efficient assembly of gatekeeper subunits with MCU
Involvement in disease : Spinocerebellar ataxia 28 (SCA28); Spastic ataxia 5, autosomal recessive (SPAX5)
Subcellular location : Mitochondrion, Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families : AAA ATPase family; Peptidase M41 family
Tissue Specificity : Ubiquitous. Highly expressed in the cerebellar Purkinje cells.
Paythway :
Uniprot ID : Q9Y4W6
Euro
British Pound
US Dollar