Product Description
Recombinant Human Alba-like protein C9orf23 (C9orf23) is available at Gentaur for Next week Delivery.
Gene Name: RPP25L
Alternative Names : Rpp25-like protein
Expression Region : 1-163aa
AA Sequence : MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 44.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May be a component of ribonuclease P or MRP.
Function : May be a component of ribonuclease P or MRP.
Involvement in disease :
Subcellular location : Nucleus
Protein Families : Histone-like Alba family
Tissue Specificity :
Paythway :
Uniprot ID : Q8N5L8
Euro
British Pound
US Dollar