Product Description
Recombinant Human ALK and LTK ligand 1 (ALKAL1) is available at Gentaur for Next week Delivery.
Gene Name: ALKAL1
Alternative Names :
Expression Region : 28-129
AA Sequence : RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-B2M-tagged
Theoretical MW : 25.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function : Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK; activation of ALK is reported conflictingly.
Involvement in disease :
Subcellular location : Secreted
Protein Families : ALKAL family
Tissue Specificity : Widely expressed with highest levels in thyroid and moderate levels in stomach, trachea, small intestine, prostate and brain.
Paythway :
Uniprot ID : Q6UXT8
Euro
British Pound
US Dollar