Recombinant Human ALK and LTK ligand 1 (ALKAL1)

Product Description

Recombinant Human ALK and LTK ligand 1 (ALKAL1) is available at Gentaur for Next week Delivery.

Gene Name: ALKAL1

Alternative Names :

Expression Region : 28-129

AA Sequence : RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-B2M-tagged

Theoretical MW : 25.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK; activation of ALK is reported conflictingly.

Involvement in disease :

Subcellular location : Secreted

Protein Families : ALKAL family

Tissue Specificity : Widely expressed with highest levels in thyroid and moderate levels in stomach, trachea, small intestine, prostate and brain.

Paythway :

Uniprot ID : Q6UXT8