Recombinant Human Alpha-hemoglobin-stabilizing protein (AHSP)

Product Description

Recombinant Human Alpha-hemoglobin-stabilizing protein (AHSP) is available at Gentaur for Next week Delivery.

Gene Name: AHSP

Alternative Names : Erythroid differentiation-related factor Erythroid-associated factor

Expression Region : 1-102aa

AA Sequence : MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 38.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia.

Function : Acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : AHSP family

Tissue Specificity : Expressed in blood and bone marrow.

Paythway :

Uniprot ID : Q9NZD4