Recombinant Human Alpha-synuclein (SNCA), partial

Product Description

Recombinant Human Alpha-synuclein (SNCA), partial is available at Gentaur for Next week Delivery.

Gene Name: SNCA

Alternative Names : Non-A beta component of AD amyloidNon-A4 component of amyloid precursor;NACP

Expression Region : 1-139AA

AA Sequence : MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 41.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.

Function : May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.

Involvement in disease : Parkinson disease 1, autosomal dominant (PARK1); Parkinson disease 4, autosomal dominant (PARK4); Dementia Lewy body (DLB)

Subcellular location : Cytoplasm, cytosol, Membrane, Nucleus, Cell junction, synapse, Secreted

Protein Families : Synuclein family

Tissue Specificity : Expressed principally in brain but is also expressed in low concentrations in all tissues examined except in liver. Concentrated in presynaptic nerve terminals.

Paythway :

Uniprot ID : P37840