Recombinant Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (AIMP2)

Product Description

Recombinant Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (AIMP2) is available at Gentaur for Next week Delivery.

Gene Name: AIMP2

Alternative Names : Multisynthase complex auxiliary component p38 Protein JTV-1

Expression Region : 1-320aa

AA Sequence : MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 39.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Required for assembly and stability of the aminoacyl-tRNA synthase complex. Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down-regulation which is required for aveolar type II cell differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.

Function : Required for assembly and stability of the aminoacyl-tRNA synthase complex

Involvement in disease :

Subcellular location : Cytoplasm, cytosol, Nucleus

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q13155