Product Description
Recombinant Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (AIMP2) is available at Gentaur for Next week Delivery.
Gene Name: AIMP2
Alternative Names : Multisynthase complex auxiliary component p38 Protein JTV-1
Expression Region : 1-320aa
AA Sequence : MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 39.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Required for assembly and stability of the aminoacyl-tRNA synthase complex. Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down-regulation which is required for aveolar type II cell differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.
Function : Required for assembly and stability of the aminoacyl-tRNA synthase complex
Involvement in disease :
Subcellular location : Cytoplasm, cytosol, Nucleus
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : Q13155
Euro
British Pound
US Dollar