Recombinant Human Aminoacylase-1 (ACY1)

Product Description

Recombinant Human Aminoacylase-1 (ACY1) is available at Gentaur for Next week Delivery.

Gene Name: ACY1

Alternative Names : N-acyl-L-amino-acid amidohydrolase

Expression Region : 1-408aa

AA Sequence : MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 72.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate).

Function : Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate).

Involvement in disease : Aminoacylase-1 deficiency (ACY1D)

Subcellular location : Cytoplasm

Protein Families : Peptidase M20A family

Tissue Specificity : Expression is highest in kidney, strong in brain and weaker in placenta and spleen.

Paythway :

Uniprot ID : Q03154