Product Description
Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP) is available at Gentaur for Next week Delivery.
Gene Name: ADTRP
Alternative Names : C6orf105
Expression Region : 1-230aa
AA Sequence : MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
Sequence Info : Full Length
Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Theoretical MW : 46.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells
Function : Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).
Involvement in disease :
Subcellular location : Cell membrane, Multi-pass membrane protein
Protein Families : AIG1 family
Tissue Specificity : Expressed in cultured endothelial cells and in placenta.
Paythway :
Uniprot ID : Q96IZ2
Euro
British Pound
US Dollar