Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP)

Product Description

Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP) is available at Gentaur for Next week Delivery.

Gene Name: ADTRP

Alternative Names : C6orf105

Expression Region : 1-230aa

AA Sequence : MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 46.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells

Function : Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : AIG1 family

Tissue Specificity : Expressed in cultured endothelial cells and in placenta.

Paythway :

Uniprot ID : Q96IZ2