Recombinant Human Apolipoprotein B-100 (APOB), partial

Product Description

Recombinant Human Apolipoprotein B-100 (APOB), partial is available at Gentaur for Next week Delivery.

Gene Name: APOB

Alternative Names : Apo B-100 (Apo B-48)

Expression Region : 28-127aa

AA Sequence : EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 14.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.

Function : Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.

Involvement in disease : Hypobetalipoproteinemia, familial, 1 (FHBL1); Familial ligand-defective apolipoprotein B-100 (FDB)

Subcellular location : Cytoplasm, Secreted

Protein Families :

Tissue Specificity :

Paythway : Cholesterolmetabolism

Uniprot ID : P04114